KEGG   Dipodomys spectabilis (banner-tailed kangaroo rat): 122124981
Entry
122124981         CDS       T07891                                 
Name
(RefSeq) succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial-like
  KO
K00237  succinate dehydrogenase (ubiquinone) membrane anchor subunit
Organism
dsp  Dipodomys spectabilis (banner-tailed kangaroo rat)
Pathway
dsp00020  Citrate cycle (TCA cycle)
dsp00190  Oxidative phosphorylation
dsp01100  Metabolic pathways
dsp01200  Carbon metabolism
dsp04714  Thermogenesis
dsp04932  Non-alcoholic fatty liver disease
dsp05010  Alzheimer disease
dsp05012  Parkinson disease
dsp05014  Amyotrophic lateral sclerosis
dsp05016  Huntington disease
dsp05020  Prion disease
dsp05022  Pathways of neurodegeneration - multiple diseases
dsp05208  Chemical carcinogenesis - reactive oxygen species
dsp05415  Diabetic cardiomyopathy
Module
dsp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dsp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dsp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    122124981
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    122124981
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    122124981
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    122124981
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122124981
   05012 Parkinson disease
    122124981
   05014 Amyotrophic lateral sclerosis
    122124981
   05016 Huntington disease
    122124981
   05020 Prion disease
    122124981
   05022 Pathways of neurodegeneration - multiple diseases
    122124981
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    122124981
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    122124981
SSDB
Motif
Pfam: CybS
Other DBs
NCBI-GeneID: 122124981
NCBI-ProteinID: XP_042555455
LinkDB
Position
Unknown
AA seq 152 aa
MTSVLRLSVLCGARGGRALFRRTSEVRPAYVSAFLQDSATPGWCGNLLPGRHAGSTAASL
HWTGERVLAVGLLGLLPAAYLNPCSAMDYSLSAALTLHSYWGLGQVVTDFVHGDTLPKVA
RAALVLFSSVTFAGLCYFNYHDVGICKAHFIR
NT seq 459 nt   +upstreamnt  +downstreamnt
atgacgtctgtgttgaggctgagcgtcctctgcggtgcccgaggaggccgagctctgttc
cgccgaacctcagaggttagacctgcttatgtctcagcatttctccaggattctgctact
ccaggatggtgtggaaacctgttgccaggccgacatgctggttccacagctgcatctctc
cattggactggtgagagggttcttgctgttggcctcttgggcctgcttccagctgcatat
ttgaatccttgctccgcgatggactactctctgtctgcagccctcacactccatagttac
tggggcctgggacaagttgttactgattttgtacatggggatacgttgccgaaagttgcc
agggcggcccttgtgctcttctcctctgtaacctttgctggcctttgttacttcaactat
catgacgtgggcatctgcaaggctcacttcatccgttaa

DBGET integrated database retrieval system