KEGG   Dichomitus squalens: DICSQDRAFT_135790
Entry
DICSQDRAFT_135790 CDS       T03133                                 
Name
(RefSeq) eukaryotic translation initiation factor 1-like protein
  KO
K24272  density-regulated protein
Organism
dsq  Dichomitus squalens
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dsq03019]
    DICSQDRAFT_135790
Messenger RNA biogenesis [BR:dsq03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     DICSQDRAFT_135790
SSDB
Motif
Pfam: SUI1 DENR_N ICAM1_3_5_D2
Other DBs
NCBI-GeneID: 18835374
NCBI-ProteinID: XP_007364908
JGI: 135790
UniProt: R7T1I8
LinkDB
Position
Unknown
AA seq 197 aa
MASAEVEASTSEVIAPKQVLYCEVCSYPVEYCEFGSSLTKCKEWLQKTDEALYNQFYSEE
ALQAKIGTLSLEAQAKLEKDTAKKEAKAEAKADAALKKKLASQVTIKRIERNKRKHVTAI
HGLEAFDVDLKKAAKFFAQRFATGASVTKNVQGFDEIVVQGDVSGEIVDMIEEGVGLLKN
VPKDNVVEVEEKGKKGS
NT seq 594 nt   +upstreamnt  +downstreamnt
atggcgagtgcagaagtggaagcatcaacatccgaagtgattgctccgaagcaggtgctg
tattgcgaagtatgctcgtaccccgtggagtactgcgagtttggatccagcctgacgaaa
tgtaaagagtggctgcagaagacggacgaggcgctctacaaccaattctactcagaagag
gcgctgcaggcgaagatcggcacgctgagcttggaggcacaagcgaagctggagaaggat
acggcgaagaaggaggcgaaggctgaggcgaaggcggatgctgcgctcaagaagaaattg
gcatcacaagtcactatcaagcggatagagcgaaacaagcgcaagcacgtcaccgccatc
catgggctcgaggcgtttgatgtcgacttgaagaaagcggcgaaattcttcgcgcagagg
ttcgcgaccggtgcatccgtcaccaagaacgtccaaggtttcgacgagattgtcgtccag
ggcgacgtgagcggcgagattgtcgacatgattgaggaaggtgtcggtctgttgaagaac
gtgcccaaggacaacgtggtggaggtggaggagaagggaaagaagggcagctga

DBGET integrated database retrieval system