Dichomitus squalens: DICSQDRAFT_15894 Help Entry DICSQDRAFT_15894  CDS       T03133                                  Name (RefSeq) hypothetical protein   KO K13993   HSP20 family protein Organism dsq  Dichomitus squalens Pathway dsq04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dsq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     DICSQDRAFT_15894  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dsq03110]     DICSQDRAFT_15894 Chaperones and folding catalysts [BR:dsq03110]  Heat shock proteins   HSP20    DICSQDRAFT_15894 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HSP20 ArsA_HSP20 Motif Other DBs NCBI-GeneID:  18837911 NCBI-ProteinID:  XP_007365553 JGI:  15894 UniProt:  R7T2Q2 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search RMDLCDDPANTHITAMLEVPGMKPEQLSVRIEGGRLIPTQNASSEPETSTPQPLYPVQEL KYGKFRREIDLPVGVNASDIRSSLVEGMLTIQWPRNP NT seq 291 nt NT seq  +upstreamnt  +downstreamnt aggatggatctatgcgacgaccctgcgaacacgcatatcaccgcaatgctagaggtcccg ggcatgaaacccgagcagctctctgtacgcatagagggtggccgccttatcccgacgcaa aacgcgtcttccgaacctgagacgtctacgccacaaccgctgtatcccgtgcaggagctc aaatatggcaagttcaggcgcgagattgacttgcctgttggggtcaacgccagtgatatc cgcagttccctcgtggagggcatgcttacaatccagtggccccgcaacccc

DBGET integrated database retrieval system