Dichomitus squalens: DICSQDRAFT_164703 Help Entry DICSQDRAFT_164703 CDS       T03133                                  Name (RefSeq) secE/sec61-gamma protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism dsq  Dichomitus squalens Pathway dsq03060   Protein export dsq04141   Protein processing in endoplasmic reticulum dsq04145   Phagosome Brite KEGG Orthology (KO) [BR:dsq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     DICSQDRAFT_164703    04141 Protein processing in endoplasmic reticulum     DICSQDRAFT_164703  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     DICSQDRAFT_164703  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dsq04131]     DICSQDRAFT_164703   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:dsq02044]     DICSQDRAFT_164703 Membrane trafficking [BR:dsq04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     DICSQDRAFT_164703 Secretion system [BR:dsq02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    DICSQDRAFT_164703 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  18838370 NCBI-ProteinID:  XP_007360345 JGI:  164703 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MSDKLKEFVEIPQQFVRDGNQFLTRCTKPSRKEFIQISKAVAIGFAVMGFIGYFVKLIHI PINNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtctgataagctcaaggagtttgttgaaattccccagcagttcgtccgcgatggcaac cagtttctgaccaggtgtacgaagccctcgcgcaaagagttcatccagatctctaaggct gtcgccatcggtttcgcggttatgggcttcattggttacttcgtcaagctcatccacatc ccaatcaacaacattctagtaggcggcgcatga

DBGET integrated database retrieval system