Dichomitus squalens: DICSQDRAFT_30636 Help Entry DICSQDRAFT_30636  CDS       T03133                                  Name (RefSeq) hypothetical protein   KO K10419   dynein light chain roadblock-type Organism dsq  Dichomitus squalens Pathway dsq04814   Motor proteins Brite KEGG Orthology (KO) [BR:dsq00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     DICSQDRAFT_30636  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dsq04131]     DICSQDRAFT_30636   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dsq03037]     DICSQDRAFT_30636    04812 Cytoskeleton proteins [BR:dsq04812]     DICSQDRAFT_30636 Membrane trafficking [BR:dsq04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     DICSQDRAFT_30636 Cilium and associated proteins [BR:dsq03037]  Motile cilia and associated proteins   Dynein arm    DICSQDRAFT_30636 Cytoskeleton proteins [BR:dsq04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      DICSQDRAFT_30636 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 UvdE Motif Other DBs NCBI-GeneID:  18841742 NCBI-ProteinID:  XP_007369104 JGI:  30636 UniProt:  R7ST42 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search PELEQTLTLLTSHRSVLGYMLLSRGQPVTIIRHSGVVFEGEQGKKYASAIARIVHSVQTG LEDDDIRFMRIRTKRHEIMISPGEHYLLAVLHDP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt cccgagctcgaacaaacgctcacgcttctcacgtcgcatcgatctgtgctgggatacatg ctattatcgagagggcaaccagtgactatcatccgccattcaggagtcgttttcgagggg gaacaagggaagaaatacgcgagtgcgatagcgcgtatcgtacacagtgtgcaaacgggc ttggaggacgacgacatacgcttcatgcggatacggacaaagcgccacgaaatcatgata tccccaggcgaacactatctgcttgccgtcttacacgatccg

DBGET integrated database retrieval system