Dichomitus squalens: DICSQDRAFT_60258 Help Entry DICSQDRAFT_60258  CDS       T03133                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism dsq  Dichomitus squalens Pathway dsq03022   Basal transcription factors dsq03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dsq00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     DICSQDRAFT_60258   09124 Replication and repair    03420 Nucleotide excision repair     DICSQDRAFT_60258  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dsq03021]     DICSQDRAFT_60258    03400 DNA repair and recombination proteins [BR:dsq03400]     DICSQDRAFT_60258 Transcription machinery [BR:dsq03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      DICSQDRAFT_60258 DNA repair and recombination proteins [BR:dsq03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      DICSQDRAFT_60258 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  18842942 NCBI-ProteinID:  XP_007365705 JGI:  60258 UniProt:  R7T0W8 LinkDB All DBs Position Unknown AA seq 53 aa AA seqDB search DSAVKQILLTMNEKGSFIIEDLDDNHLVIKADEEYRVRRELEAELEKNTYSLE NT seq 162 nt NT seq  +upstreamnt  +downstreamnt gactccgcggtgaagcagatcctcctgacgatgaacgagaagggcagcttcatcatagag gacttggatgataatcatcttgtgatcaaggcggacgaggagtatcgggtgaggagggag cttgaggctgagctggagaaaaatacctacagcttggagtga

DBGET integrated database retrieval system