Dichomitus squalens: DICSQDRAFT_73028 Help Entry DICSQDRAFT_73028  CDS       T03133                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism dsq  Dichomitus squalens Pathway dsq03020   RNA polymerase dsq03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dsq00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     DICSQDRAFT_73028   09124 Replication and repair    03420 Nucleotide excision repair     DICSQDRAFT_73028  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dsq03021]     DICSQDRAFT_73028    03400 DNA repair and recombination proteins [BR:dsq03400]     DICSQDRAFT_73028 Transcription machinery [BR:dsq03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      DICSQDRAFT_73028   RNA polymerase III system    RNA polymerase III      DICSQDRAFT_73028   RNA polymerase I system    RNA polymerase I      DICSQDRAFT_73028 DNA repair and recombination proteins [BR:dsq03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       DICSQDRAFT_73028 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N CAMSAP_CH Motif Other DBs NCBI-GeneID:  18843918 NCBI-ProteinID:  XP_007371515 JGI:  73028 UniProt:  R7SJ56 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search IIPVRCFSCGKVVGDKWTAYLDLLAKDISEGDALDQLQLKRYCCRRMVLTHVDLIEKLLH YNRASSSSRLLPPRSPPSPSE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt attatccctgtacgctgcttctcctgcggaaaggtggtgggcgacaagtggactgcgtat ctggatctattggccaaggatatcagcgagggtgatgcgcttgaccaactccagctcaag cgctactgttgtcgccgcatggtcctcacacatgtcgacctcatagagaagctcctccat tacaatcgtgcgtcgtcctcttctcgcctcctgcccccgcgctcacccccttctcctagc gaatga

DBGET integrated database retrieval system