Dichomitus squalens: DICSQDRAFT_92137 Help Entry DICSQDRAFT_92137  CDS       T03133                                  Name (RefSeq) ubiquitin-like protein   KO K13113   ubiquitin-like protein 5 Organism dsq  Dichomitus squalens Brite KEGG Orthology (KO) [BR:dsq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:dsq03041]     DICSQDRAFT_92137   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dsq04052]     DICSQDRAFT_92137 Spliceosome [BR:dsq03041]  Complex B   Other components    Complex B specific factors     DICSQDRAFT_92137 Cytokines and neuropeptides [BR:dsq04052]  Neuropeptides   Unclassified    DICSQDRAFT_92137 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Crinkler PI3K_rbd Motif Other DBs NCBI-GeneID:  18844955 NCBI-ProteinID:  XP_007369739 JGI:  92137 UniProt:  R7SNM4 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MPLIEVIANDRLGRKVRVKCSPDDTVGDLKKLIAAQTGTDPSKIQLKKWYTIYKDHITLA DYEIHDGMSLEMY NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcctctcattgaagtcatcgcgaacgaccggcttgggcgcaaagtgcgcgtcaagtgc agtccagacgacaccgttggcgacctcaagaagctcatcgcggcccagacgggtacggat ccgtccaagatccagctcaagaaatggtacacgatctacaaggaccatatcacactcgca gactatgagatacacgacggcatgagtcttgagatgtattag

DBGET integrated database retrieval system