Drosophila serrata: 110176698 Help Entry 110176698         CDS       T06108                                  Name (RefSeq) ras-related protein Rac2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dsr  Drosophila serrata Pathway dsr04013   MAPK signaling pathway - fly dsr04145   Phagosome dsr04148   Efferocytosis dsr04310   Wnt signaling pathway dsr04620   Toll-like receptor signaling pathway dsr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dsr00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     110176698    04310 Wnt signaling pathway     110176698  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110176698    04148 Efferocytosis     110176698  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110176698  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110176698  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dsr04131]     110176698   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dsr04147]     110176698    04031 GTP-binding proteins [BR:dsr04031]     110176698 Membrane trafficking [BR:dsr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110176698  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110176698   Macropinocytosis    Ras GTPases     110176698  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110176698 Exosome [BR:dsr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110176698   Exosomal proteins of other body fluids (saliva and urine)    110176698   Exosomal proteins of colorectal cancer cells    110176698   Exosomal proteins of bladder cancer cells    110176698 GTP-binding proteins [BR:dsr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110176698 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  110176698 NCBI-ProteinID:  XP_020798792 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLR DDKQTIEKLKEKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPV IRTRPRHKCELL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgcgtggttgtgggcgacggagcggtgggtaagacctgcctgctg atcagctatacgaccaacgcctttccgggggaatatattcccactgtcttcgataactac tccgccaatgtgatggtggatgccaaacccatcaatctgggactctgggatacggccgga caggaggattacgatcgcctgaggccactctcgtatccccaaacggatgtcttcctcatc tgcttctcgctggtgaatcccgcctcctttgagaacgtgcgggccaagtggttccccgag gtgcgtcaccattgccccagtgtcccgatcatcctcgttggcaccaagttggatctgcgc gacgacaagcagaccattgagaagctgaaggagaagaagctcacaccgatcacgtatccg caaggactcgcgatggccaaggaaattgcagcagtcaagtacttggaatgctcggcgcta acgcaaaagggcctgaagacggtcttcgatgaggccatccggtcggtgctgtgtccggtg atccgcacccgtccgcgccacaagtgcgagctgctctaa

DBGET integrated database retrieval system