KEGG   Drosophila serrata: 110177859
Entry
110177859         CDS       T06108                                 
Name
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
dsr  Drosophila serrata
Pathway
dsr03083  Polycomb repressive complex
dsr04120  Ubiquitin mediated proteolysis
dsr04141  Protein processing in endoplasmic reticulum
dsr04310  Wnt signaling pathway
dsr04341  Hedgehog signaling pathway - fly
dsr04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110177859
   04120 Ubiquitin mediated proteolysis
    110177859
  09126 Chromosome
   03083 Polycomb repressive complex
    110177859
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110177859
   04341 Hedgehog signaling pathway - fly
    110177859
   04350 TGF-beta signaling pathway
    110177859
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsr04131]
    110177859
   04121 Ubiquitin system [BR:dsr04121]
    110177859
   03036 Chromosome and associated proteins [BR:dsr03036]
    110177859
Membrane trafficking [BR:dsr04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    110177859
Ubiquitin system [BR:dsr04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     110177859
   Cul7 complex
     110177859
Chromosome and associated proteins [BR:dsr03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     110177859
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     110177859
SSDB
Motif
Pfam: Skp1 Skp1_POZ Imm5
Other DBs
NCBI-GeneID: 110177859
NCBI-ProteinID: XP_020800465
LinkDB
Position
Unknown
AA seq 161 aa
MPLIRLESSDKEIFETDQEIAKCSETIRIALEDLGDEADNSVLPVPNVNSLILKKVLHWA
TYHKDDPMVAEEDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKT
VANMIKGKSPQEIRETFALKNDFLPQEEEQVRKENEWCEEK
NT seq 486 nt   +upstreamnt  +downstreamnt
atgcctctcatccgtctggagtcctccgacaaggagatctttgaaactgaccaagagatc
gccaagtgctcggagactatccgcattgctctcgaggatctgggcgatgaggctgacaac
agcgttctccctgttccgaacgttaactcgctgatccttaagaaggtgctccactgggcc
acgtaccacaaggacgacccaatggttgccgaggaggacgagaacaaggaaaagcgtacc
gacgacatctcctcctgggacgccgacttcctcaaggtcgaccagggcactctgttcgag
ctgatcctggcggctaactacctgaacattcagggactgcttgacgtcacctgcaagact
gtggccaacatgatcaagggcaaatcgccgcaggaaattcgcgagacgttcgctttgaag
aacgacttcttgccgcaggaggaggagcaggttcgcaaagagaacgagtggtgtgaggag
aagtaa

DBGET integrated database retrieval system