Drosophila serrata: 110180675 Help Entry 110180675         CDS       T06108                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism dsr  Drosophila serrata Brite KEGG Orthology (KO) [BR:dsr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dsr03036]     110180675   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dsr04147]     110180675 Chromosome and associated proteins [BR:dsr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110180675 Exosome [BR:dsr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110180675 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone p450 BAR ETRAMP PUF_NOP9 Motif Other DBs NCBI-GeneID:  110180675 NCBI-ProteinID:  XP_020804020 LinkDB All DBs Position Unknown AA seq 84 aa AA seqDB search MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRRRAMLSTFTSFVNDIFERIAAEASRLAHY NKRSNHHQSGNPNCCSPAPARRVG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgccgccgaaaactagtggaaaggcagccaagaaggctggcaaggcccagaagaacatc accaagaacgacaagaagaagaagcggaagaggaggagagctatgctatctacatttaca agctttgtgaatgacatcttcgagcgtattgctgccgaggcttctcgtctggcgcactac aacaagcgctctaaccatcaccagtcgggaaatccaaactgctgttcgcctgctcctgcc cggagagttggctaa

DBGET integrated database retrieval system