KEGG   Drosophila serrata: 110181858
Entry
110181858         CDS       T06108                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dsr  Drosophila serrata
Pathway
dsr00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    110181858
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dsr00199]
    110181858
Enzymes [BR:dsr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     110181858
Cytochrome P450 [BR:dsr00199]
 Cytochrome P450, animal type
  CYP306 family
   110181858
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 110181858
NCBI-ProteinID: XP_020805436
LinkDB
Position
Unknown
AA seq 605 aa
MSSSSSIVDMGSTGWMPSLQSLSVFIVPGLLIGVILYLCEHQYDDVLGVPPPGPWGLPIL
GYLPFLDARAPHKSLQALAKRYGGIFQLRMGNIRTVFLSDVALVREFFRHEEMTDRAPLY
VTHGIMGGYGIICAQGDIWKHARREVIDWLKSLGMTRRPGERRSHLEQRIGRGVNECVQL
FGQEADESRNSEFDPQGALHHSLGNIINDLVFGITYARNDPDWLYLQRLQEHGVKLIGVS
GVVNFLPWLRRLPSQARNIQFLLEGKAKTHAIYDRIAAACSERLQKKLALHNERVELIRQ
QEQLEERRQRESQHGQVGEESEAPELAEEPEEAVPSAEEGDEDHSHCQRHPPQLIEYSEE
DERHKYQPHCILEHFLVDRKEGSQLYCDEQLRHLLADLYGAGVDTALATLRWFLVYMARE
QACQRRLHELLLPLDATPSLEELEPLAYLRACLAETQRIRSVVPLGIPHGCERDFTVGDY
RIQGGTMIVSLMWGIHMDPQAFPQPEEFRPERFLGPDGGYVAPPQFIPFQVGKRMCPGDE
LARMMLTLFAGRILRRFHLEVAPDSRDMDMAGESGITLTPAPYKLRFTRLPERMELMREE
VLRDE
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcatcgtccattgtagacatgggcagcaccggctggatgccctccctgcaa
agccttagtgtgtttatcgttccgggactccttattggcgtgatcctttacctttgtgag
catcagtatgatgacgtcctgggcgtaccgccaccgggaccttggggtttacccatactg
ggttatctgccctttttggatgcaagagctccacacaaatccctgcaagctttggccaaa
cgttatggcggaatctttcagctacgaatgggtaacattcggacggtattcctctcggat
gtggctctggtaagggagttctttcgccacgaggaaatgacggatcgggcaccactttac
gtcacacatggcattatgggtggttatggaatcatctgcgcccagggtgacatttggaaa
catgcccgtcgagaggttatcgactggctgaaatccctgggcatgacccgtcgtccagga
gagcggcggagtcacctcgagcagcgcattggtcggggtgtgaacgagtgcgtacagctc
tttggccaagaggcagatgagagtcgcaactcggagtttgatccccaaggagcgctccat
cattcactgggcaacatcatcaacgatctggtctttggtatcacctatgcccgcaatgat
cccgactggctgtacttgcagcgtctgcaggagcacggagtcaagctcatcggtgtctcc
ggagtggtcaacttcctgccctggctacgccgcctgccctcgcaggctcggaatatccag
ttcctgctggagggcaaggccaagacacatgccatatatgatcgcatagcggccgcctgc
tccgagcgccttcaaaagaagctagctcttcacaatgagcgcgtggagctgatacgtcag
caggagcaactagaggagaggaggcaacgggagagtcagcatggacaagtgggggaggaa
tcagaagcgcctgagctggccgaggagcctgaggaggctgtaccctctgcggaggagggt
gacgaggaccacagccattgtcaacgacatccaccccagctgatcgagtatagcgaagag
gacgagcggcacaagtatcaaccgcactgcatcctggagcactttctcgtcgatcggaag
gaagggtcacagctttattgcgacgaacagctgcgccatctgctcgccgacctttatgga
gccggcgtggacaccgccctggccactctccgctggttcctagtctatatggcccgcgag
caggcctgccagcgacggctccatgagctgctcctcccgctggatgccacaccctcgctg
gaggagctggaaccgctggcctatctacgtgcctgcctggcggagacgcaacgcatacgc
agcgtggtcccgctgggcattccccatggctgtgagcgtgacttcaccgtgggtgactat
cgcatccagggcggcaccatgattgtctccctgatgtggggcattcatatggatccccag
gcctttccacagcccgaggaattccgaccggagcgtttccttggtcccgatgggggatat
gtggcaccaccacagttcattcccttccaggtgggcaaacgcatgtgtcccggcgatgag
ctggcccgcatgatgctcaccctctttgcggggcgcatcctgcgtcgcttccacctggag
gtggctccggatagccgggacatggacatggctggtgagagtggcatcaccttgactccc
gctccctacaagctgcgattcaccaggctgccagagcgaatggagctgatgagggaggag
gtgctgcgggatgagtaa

DBGET integrated database retrieval system