Drosophila serrata: 110182443 Help Entry 110182443         CDS       T06108                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism dsr  Drosophila serrata Brite KEGG Orthology (KO) [BR:dsr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dsr03036]     110182443   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dsr04147]     110182443 Chromosome and associated proteins [BR:dsr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110182443 Exosome [BR:dsr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110182443 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  110182443 NCBI-ProteinID:  XP_020806137 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MDESIFLFGRVGSIGGQIRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC AIHAKRVTIMPKDIQLARRIRGERA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggacgagtctatttttttattcggacgtgttggttcgattggcggacaaattcgtctg gtgcgtgaaatcgctcaggacttcaagactgacctgcgattccagagctctgccgtaatg gctctgcaggaagctagcgaagcctatctggttggtctctttgaagacaccaacttgtgt gccatccacgccaagcgagtcacaatcatgcccaaggacatccagctggcccgtcgcatc cgtggcgagcgtgcttaa

DBGET integrated database retrieval system