Drosophila serrata: 110186927 Help Entry 110186927         CDS       T06108                                  Name (RefSeq) drosomycin-like   KO K20670   drosomycin Organism dsr  Drosophila serrata Pathway dsr04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:dsr00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     110186927  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dsr02000]     110186927 Transporters [BR:dsr02000]  Other transporters   Accessory factors involved in transport [TC:8]    110186927 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gamma-thionin Toxin_3 Motif Other DBs NCBI-GeneID:  110186927 NCBI-ProteinID:  XP_020811916 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MSISKNGAVKFLCLFLAIMTIAVLDSNVAEARDCLSRTFSGPCWAWSGEQCRRLCKEEGR VSGHCSSSMKCWCEGC NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtatcagtaaaaatggtgcagttaagttcctgtgtcttttccttgccatcatgacg attgcggttctggactccaacgtggctgaggcaagagactgcctttctagaacgttttct ggaccctgttgggcttggagcggtgaacagtgccgacgcctttgcaaggaagaaggacgt gtcagtggacattgcagttccagtatgaaatgttggtgtgaaggatgctga

DBGET integrated database retrieval system