Drosophila serrata: 110186983 Help Entry 110186983         CDS       T06108                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dsr  Drosophila serrata Pathway dsr04013   MAPK signaling pathway - fly dsr04145   Phagosome dsr04148   Efferocytosis dsr04310   Wnt signaling pathway dsr04517   IgSF CAM signaling dsr04518   Integrin signaling dsr04620   Toll-like receptor signaling pathway dsr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dsr00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     110186983    04310 Wnt signaling pathway     110186983   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     110186983    04518 Integrin signaling     110186983  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110186983    04148 Efferocytosis     110186983  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110186983  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110186983  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dsr04131]     110186983   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dsr04147]     110186983    04031 GTP-binding proteins [BR:dsr04031]     110186983 Membrane trafficking [BR:dsr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110186983  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110186983   Macropinocytosis    Ras GTPases     110186983  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110186983 Exosome [BR:dsr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110186983   Exosomal proteins of other body fluids (saliva and urine)    110186983   Exosomal proteins of colorectal cancer cells    110186983   Exosomal proteins of bladder cancer cells    110186983 GTP-binding proteins [BR:dsr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110186983 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  110186983 NCBI-ProteinID:  XP_020812001 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR DDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV LQPKSKRKCALL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaagtgcgtcgtggtgggcgatggagccgtgggaaagacgtgcctgctg atcagctatacgaccaatgcctttcccggggaatatatccccactgtttttgacaactac tccgccaacgtgatggtggacgcgaagcctattaatctgggactatgggataccgctgga caggaggactatgaccgcctccgaccactgtcgtatccgcagaccgatgtcttcctcatc tgcttttcgctggtgaatccggcctcgttcgagaacgtgcgggccaaatggtatccggag gtgcgtcaccactgccccagcacgcccatcatccttgtgggcaccaagctggatttgcgc gacgacaagaacacgatcgagaagctgcgcgacaagaagctggcgccgatcacttacccg cagggtctggccatggccaaggagatcggtgcggtcaagtatctggagtgctcggcgttg acgcaaaagggcctgaagacggtgtttgatgaggccattcggtcggtcttgtgcccggtc ctacagcccaagtccaagcgcaagtgcgccctgctctaa

DBGET integrated database retrieval system