Drosophila serrata: 110187399 Help Entry 110187399         CDS       T06108                                  Name (RefSeq) drosomycin-like   KO K20670   drosomycin Organism dsr  Drosophila serrata Pathway dsr04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:dsr00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     110187399  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dsr02000]     110187399 Transporters [BR:dsr02000]  Other transporters   Accessory factors involved in transport [TC:8]    110187399 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gamma-thionin Toxin_3 Defensin Motif Other DBs NCBI-GeneID:  110187399 NCBI-ProteinID:  XP_020812451 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MIQIKFLCLFLALMTIAVLDTNVAEARDCLSGTFKGPCWAWSGEKCRRLCIEEGHVSGHC SGGSKCWCEQC NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgatccagatcaagttcctgtgccttttcctcgccctcatgacaatagctgtcctggac accaacgtggctgaagccagagactgcctttctggaacattcaaaggaccctgctgggct tggagtggagagaagtgccgccgcctttgcattgaggagggacatgttagtggacattgc agtggcggctcaaaatgttggtgcgagcagtgttaa

DBGET integrated database retrieval system