Drosophila serrata: 110188240 Help Entry 110188240         CDS       T06108                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism dsr  Drosophila serrata Pathway dsr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dsr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110188240  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dsr04121]     110188240    03400 DNA repair and recombination proteins [BR:dsr03400]     110188240 Ubiquitin system [BR:dsr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      110188240    Cul5 complex      110188240 DNA repair and recombination proteins [BR:dsr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110188240 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD GABP-alpha Ubiquitin_2 Ubiquitin_TPR1 Motif Other DBs NCBI-GeneID:  110188240 NCBI-ProteinID:  XP_020813561 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQPVDQRLYNQDNDVMDDDSTLQD YGVTVSTAKAQSPAQLGLTFRNEVGDFETLDMSPYSAPPDLPEVMKNQEASNGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtattccttatgatcaggcggcagaagaccaccatcttcacggacgccaaggag aacacaacggtggccgaactgaagcgaatgattgaaggcatactgaaggtgcagcctgtg gaccagcggttatacaatcaggacaacgatgttatggacgacgacagcacgttgcaggac tacggcgtgacggtgtccacggccaaggcgcagtctccggcgcagctgggcttgacattc agaaacgaagtgggcgattttgagacactggacatgtcaccatactcggcaccaccagac ttacctgaagtgatgaaaaaccaagaggcctcgaacggacaggagcaagttgcataa

DBGET integrated database retrieval system