Drosophila serrata: 110190725 Help Entry 110190725         CDS       T06108                                  Name (RefSeq) probable insulin-like peptide 1   KO K04526   insulin Organism dsr  Drosophila serrata Pathway dsr04068   FoxO signaling pathway dsr04081   Hormone signaling dsr04140   Autophagy - animal dsr04150   mTOR signaling pathway dsr04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:dsr00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     110190725    04150 mTOR signaling pathway     110190725   09133 Signaling molecules and interaction    04081 Hormone signaling     110190725  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110190725  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     110190725  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dsr04052]     110190725 Cytokines and neuropeptides [BR:dsr04052]  Neuropeptides   Unclassified    110190725 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  110190725 NCBI-ProteinID:  XP_020817006 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MFCQDTGAVHGLRMLIAMLPIIAILASGHQLPTGNHKLCGSALSEALDLVCANGYNTLPQ KRLPQSGVPGADYSSSPLAHLLLSNWYALEDGDGDVASGFGIKTRRQRRHFPGGVYDECC VSPCSYDEISAYCLSN NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgttttgccaggacaccggtgcagttcatggtctgcggatgctaatcgctatgctgccc attatagccatcctggccagtggtcatcagctgccaaccggcaaccacaaactttgtggt tccgcgctctccgaagccctggatctggtgtgcgccaatggctataacacgctgccccag aagcgtttaccacagtccggtgtgccaggagcagactactcctcctccccattggcacac ctgctgctgtccaattggtatgcactcgaagatggcgacggagatgtggcctctggtttt gggatcaagacacggcgccagaggagacacttccccggtggcgtttacgatgagtgctgt gtgtccccctgctcctacgacgagatatccgcctattgcctgtccaattga

DBGET integrated database retrieval system