Demequina sediminis: GCM25873_08060 Help Entry GCM25873_08060    CDS       T09136                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism dss  Demequina sediminis Pathway dss03060   Protein export dss03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:dss00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GCM25873_08060  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GCM25873_08060  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:dss02044]     GCM25873_08060 Secretion system [BR:dss02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    GCM25873_08060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Auxin_repressed Motif Other DBs NCBI-ProteinID:  BDZ61015 LinkDB All DBs Position 753925..754203 Genome browser AA seq 92 aa AA seqDB search MGPREILIILVIVLLLFGAPKLPQLARSLGQSLRILKDETSSLTSDSKDGASTSGAAPAM PPAPGAAATPVAPSTPDTTATSSSDEPRDGEK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgggacctcgcgagatcctcatcatcctcgtcatcgtgctgctgctgttcggcgccccg aagctcccgcagctcgcgcgctcgctgggccagtcgctgcgcatcctcaaggacgagacg tcgtcgctcacgagcgactcgaaggacggcgcctcgacgtccggcgcggcccccgcgatg cctccggccccgggcgccgccgcgactcccgtggcgccgtcgacgccagacaccaccgcg acgtcgtcctcggacgagccgcgtgacggcgagaagtag

DBGET integrated database retrieval system