Azospira oryzae: Dsui_0244 Help Entry Dsui_0244         CDS       T01657                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism dsu  Azospira oryzae Brite KEGG Orthology (KO) [BR:dsu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dsu03036]     Dsui_0244 Chromosome and associated proteins [BR:dsu03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Dsui_0244 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC FtsL_2 Motif Other DBs NCBI-ProteinID:  AEV24664 UniProt:  G8QMT4 LinkDB All DBs Position complement(244990..245259) Genome browser AA seq 89 aa AA seqDB search MLRLNLFLLLAAMICALGVVTSQHKARKLFQELEGEQERARSLDVEWGQLQLELSTWATH PRIEKIARDKLHMHAPEPAKVINVPAGGR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgctgcgcctcaacctgttcctgctgctggcggccatgatctgcgccctgggcgtggtc acctcccagcacaaggcgcgcaagctgttccaggaactggaaggggagcaggagcgggcc cgcagcctggatgtggaatggggccagctgcagctggaactgtccacctgggccacccat ccccgcatcgagaaaatcgcccgggacaagctgcacatgcatgcgccggagccggcgaag gtgatcaacgtgcccgcaggaggccgctga

DBGET integrated database retrieval system