Azospira oryzae: Dsui_1764 Help Entry Dsui_1764         CDS       T01657                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dsu  Azospira oryzae Pathway dsu01100   Metabolic pathways dsu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dsu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dsui_1764    00074 Mycolic acid biosynthesis     Dsui_1764   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dsui_1764 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEV26149 UniProt:  G8QG76 LinkDB All DBs Position 1852703..1852915 Genome browser AA seq 70 aa AA seqDB search MVLAVLATVLKCEVNPDSSRKNTPQWDSLKHIEVIFAIEDELGLQFSEEALAELNSVSQI VDGALALHAA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt ttggtgctggccgttcttgccactgttctcaaatgcgaagtgaatcccgacagctcgcgc aagaacacgccccaatgggactccttgaagcacatcgaggtcatttttgccatcgaggat gaattgggcctgcaattctcggaggaagcgctggccgagctgaatagcgtcagccagatt gtggatggagctttggccctccatgcggcatga

DBGET integrated database retrieval system