Azospira oryzae: Dsui_1967 Help Entry Dsui_1967         CDS       T01657                                  Name (GenBank) DNA-binding protein H-NS   KO K03746   DNA-binding protein H-NS Organism dsu  Azospira oryzae Brite KEGG Orthology (KO) [BR:dsu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dsu03036]     Dsui_1967    03400 DNA repair and recombination proteins [BR:dsu03400]     Dsui_1967 Chromosome and associated proteins [BR:dsu03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     Dsui_1967 DNA repair and recombination proteins [BR:dsu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       Dsui_1967 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS SCGB3A Motif Other DBs NCBI-ProteinID:  AEV26339 UniProt:  G8QHY5 LinkDB All DBs Position 2076088..2076405 Genome browser AA seq 105 aa AA seqDB search MDISSLSLAELKLLQQQIPLEIKKREVQEKEKVLNELKLIAESRGFSLDQLLKGGEKGKA KSGRSVQVKYRHPQNADLAWTGRGRKPQWVQEWLNGGRKIEELAV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggatatttcttccctgtccctggccgaactgaagcttctgcaacagcaaattcccctg gaaatcaaaaagcgcgaggttcaggaaaaggaaaaagtcctgaatgaattgaaactgatt gccgaatcccggggcttttccctggatcagctgctcaagggcggcgaaaagggcaaggcc aagtccggccgcagcgttcaggtgaaataccgccatccccagaatgccgacctggcctgg accggtcgcggccgcaaaccccagtgggtgcaggaatggctgaacggcgggcgcaagatc gaggaactggctgtctga

DBGET integrated database retrieval system