Dermacentor silvarum: 119431377 Help Entry 119431377         CDS       T07348                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism dsv  Dermacentor silvarum Pathway dsv04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dsv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     119431377  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dsv04121]     119431377    03400 DNA repair and recombination proteins [BR:dsv03400]     119431377 Ubiquitin system [BR:dsv04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      119431377    Cul5 complex      119431377 DNA repair and recombination proteins [BR:dsv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      119431377 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  119431377 NCBI-ProteinID:  XP_037554790 LinkDB All DBs Position 10:6448596..6453880 Genome browser AA seq 117 aa AA seqDB search MSEDKPMDEGTVYGGCEGPDAMYVKLISSDGHEFIIKRMHALTSGTIKAMLSGPGQFAEN ETNEVNFREIPSHVLQKVCQYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtctgaggacaagcccatggatgagggcacggtgtacggcggctgcgaggggccagat gccatgtacgtcaagctcatctcatctgatggccacgagttcatcatcaagcgcatgcat gcgctcacatcaggaaccatcaaggctatgctgtcaggtccgggccagtttgccgagaac gagaccaacgaggtgaacttccgagagataccgtctcatgtgctgcagaaggtgtgccag tacttcacatacaaggtgcgctacacaaacagctccactgagatccctgagttccccatt gccccagagattgcccttgagctgctcatggcagcaaacttcctcgactgctga

DBGET integrated database retrieval system