Dermacentor silvarum: 119441776 Help Entry 119441776         CDS       T07348                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dsv  Dermacentor silvarum Pathway dsv04145   Phagosome dsv04148   Efferocytosis dsv04310   Wnt signaling pathway dsv04517   IgSF CAM signaling dsv04518   Integrin signaling dsv04620   Toll-like receptor signaling pathway dsv05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dsv00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     119441776   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     119441776    04518 Integrin signaling     119441776  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     119441776    04148 Efferocytosis     119441776  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119441776  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     119441776  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dsv04131]     119441776   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dsv04147]     119441776    04031 GTP-binding proteins [BR:dsv04031]     119441776 Membrane trafficking [BR:dsv04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     119441776  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     119441776   Macropinocytosis    Ras GTPases     119441776  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     119441776 Exosome [BR:dsv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119441776   Exosomal proteins of other body fluids (saliva and urine)    119441776   Exosomal proteins of colorectal cancer cells    119441776   Exosomal proteins of bladder cancer cells    119441776 GTP-binding proteins [BR:dsv04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     119441776 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Auxin_BP MMR_HSR1 Omega_Repress Motif Other DBs NCBI-GeneID:  119441776 NCBI-ProteinID:  XP_037562312 LinkDB All DBs Position 2:131615322..131666188 Genome browser AA seq 188 aa AA seqDB search MAQSRPIKMVVVGDGMVGKTCLLVAFTTGAFPGTDYEPTVFDNYAGSLVVDGVTANLTLW DTAGQEDYEKLRPLSYPGSDVFLLCFSISSEASYNNILTKWQPELKHHCPTTPYVLVATK ADLRQEETAEDLVSRAAGKKLASKIKAYSYIECSAKTGERVKEVFEEAARAVLQPKSSRK KKLPCRFL NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggcgcagagtcggcccatcaagatggtggtggtgggtgacggcatggtgggcaagacc tgcctgctggtcgcattcactaccggagcctttcccggcaccgactacgagccgaccgtc ttcgacaactacgccgggagcttggtcgtggacggcgtcactgccaacctgacgctgtgg gacaccgcgggtcaagaggactacgagaagctgaggccgctttcctaccctgggtcggac gtcttcctgctgtgcttcagcatcagcagcgaagcctcgtataacaacatcttgacaaag tggcaacccgagctcaagcatcactgccccacgacgccgtacgtcttagtagctaccaag gctgacctgcgccaggaggagacggcagaggacctcgtgagcagagcagcgggcaagaag ctggcctccaagatcaaagcttacagctacatcgagtgctcagccaagacgggagagcgt gtcaaagaggtcttcgaagaggcggcccgggcagtactccagcccaaatcttcaagaaag aagaagttaccttgtaggtttttatag

DBGET integrated database retrieval system