Dermacentor silvarum: 119453550 Help Entry 119453550         CDS       T07348                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dsv  Dermacentor silvarum Pathway dsv04145   Phagosome dsv04148   Efferocytosis dsv04310   Wnt signaling pathway dsv04620   Toll-like receptor signaling pathway dsv05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dsv00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     119453550  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     119453550    04148 Efferocytosis     119453550  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119453550  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     119453550  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dsv04131]     119453550   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dsv04147]     119453550    04031 GTP-binding proteins [BR:dsv04031]     119453550 Membrane trafficking [BR:dsv04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     119453550  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     119453550   Macropinocytosis    Ras GTPases     119453550  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     119453550 Exosome [BR:dsv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119453550   Exosomal proteins of other body fluids (saliva and urine)    119453550   Exosomal proteins of colorectal cancer cells    119453550   Exosomal proteins of bladder cancer cells    119453550 GTP-binding proteins [BR:dsv04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     119453550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  119453550 NCBI-ProteinID:  XP_037571531 LinkDB All DBs Position 5:complement(82604283..82634810) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVSHHCPNTPIILVGTKLDLR EDKDTVEKLRDRKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKNVFDEAIRAVLCPQ PKPKKRRPCSLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgataaagtgcgtggtcgtcggcgacggcgccgttggtaaaacctgtctcctc atcagctacaccaccaatgccttccctggggagtacatacccacagtgttcgacaactac tcggccaatgtcatggtcgatggcaagcccatcaaccttggcctctgggatacagccggt caggaggactacgaccggcttcggccactctcctacccacagacggatgtctttctcatc tgcttctccttggtgaacccggcatcctttgaaaacgtcagggcgaagtggtaccccgag gtgagccaccactgccccaacacgcccatcatcctggtgggcaccaagctcgacctgcgg gaggacaaggacaccgtggagaagctgcgcgaccgcaagcttgcccccatcacgtacccg caggggctggccatggccaaagagatcggcgccgtcaagtacctcgagtgctccgccctc acccagaagggcctgaagaacgtcttcgacgaggccatccgcgcggtgctctgcccgcag cccaagcccaagaagcggcgcccttgctcactgctctga

DBGET integrated database retrieval system