Dermacentor silvarum: 119456467 Help Entry 119456467         CDS       T07348                                  Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism dsv  Dermacentor silvarum Pathway dsv03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:dsv00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     119456467  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dsv03036]     119456467    03400 DNA repair and recombination proteins [BR:dsv03400]     119456467 Chromosome and associated proteins [BR:dsv03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      119456467 DNA repair and recombination proteins [BR:dsv03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      119456467 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa Motif Other DBs NCBI-GeneID:  119456467 NCBI-ProteinID:  XP_037574205 LinkDB All DBs Position 6:178821963..178822981 Genome browser AA seq 118 aa AA seqDB search MSRDPDEVERLSHAACLKAAVHYTVGRICEDMAEAEGGLPVQRQTVAALTELVHHEVGRV ARDLSMLALHCRRSTVNADDVLFIARNSGELHEYLQSLVPTPKKTDGKRKVSAKGLQE NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgtcgcgagaccccgacgaagtggagcggttgagtcatgcggcgtgcctcaaagccgcc gtacactacacagtgggtcgcatctgcgaagacatggccgaggcagagggaggccttcct gtgcagcggcaaacggtggcagctctgactgaactggtccaccacgaagttggccgtgtg gctcgcgaccttagtatgctggcactacactgtcgcagaagcaccgtgaatgccgacgac gtgctgttcatcgcgagaaactctggcgagttgcacgagtatctccagagcctggtgcct acacccaagaagaccgacggcaagcgtaaagtttctgccaagggacttcaagagtga

DBGET integrated database retrieval system