Deinococcus radiopugnans: QR90_13960 Help Entry QR90_13960        CDS       T03508                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dsw  Deinococcus radiopugnans Pathway dsw01100   Metabolic pathways dsw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dsw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QR90_13960    00074 Mycolic acid biosynthesis     QR90_13960   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QR90_13960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AIZ45934 UniProt:  A0A0A7KL29 LinkDB All DBs Position 2990462..2990692 Genome browser AA seq 76 aa AA seqDB search MATFDDVKDVIVDKLGVDADKVNPEARFVEDLGADSLETVELIMGLEDKFGVTISDEDAE TIRTVQAAVDYIEGKQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcgacttttgatgacgtgaaagatgtgattgtggacaagctgggtgtggatgcggac aaggtgaaccccgaggcccgcttcgtggaagacctgggcgccgacagcctggaaacagtg gaactgatcatgggtctggaagacaagtttggcgtgaccatcagcgatgaggacgccgag accatccgcaccgtgcaggccgccgtcgattacatcgagggcaagcagtaa

DBGET integrated database retrieval system