Deinococcus radiopugnans: QR90_15015 Help Entry QR90_15015        CDS       T03508                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism dsw  Deinococcus radiopugnans Pathway dsw03060   Protein export dsw03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:dsw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     QR90_15015  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     QR90_15015  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:dsw02044]     QR90_15015 Secretion system [BR:dsw02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    QR90_15015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AIZ46095 UniProt:  A0A0A7KJ26 LinkDB All DBs Position 3204284..3204547 Genome browser AA seq 87 aa AA seqDB search MPNIGPAELIVILLVALVVFGPRKLPELGKSLGHGLREFRKSTQGLKAELDGVNIVATPV VEQPVTVAQTAAPVAAAAVTPPRNAEA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcccaacatcggccccgcagaactgatcgtgattttactggttgccctggtggtgttc ggcccccgcaaactgcctgaactgggcaagagcctgggccacggcctgcgcgaattccgc aagagcacccagggcctcaaggccgaactggacggcgtgaacatcgtcgccaccccggtg gtcgagcagccggtcacggtggcccagaccgccgccccggtggccgctgccgccgtcacg ccgccccgcaacgccgaggcctga

DBGET integrated database retrieval system