Desulfolutivibrio sulfoxidireducens: GD604_02940 Help Entry GD604_02940       CDS       T06821                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism dsx  Desulfolutivibrio sulfoxidireducens Brite KEGG Orthology (KO) [BR:dsx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dsx03036]     GD604_02940 (zapB) Chromosome and associated proteins [BR:dsx03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     GD604_02940 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB DUF7310 HALZ Filament bZIP_1 CCDC144C OVT1 DivIC Rab11-FIP3 CC_Bre1 ODAD1_CC betaPIX_CC GAS FlaC_arch Imm7 Viral_P18 TMF_TATA_bd YabA BAR_4 TSC22 Ran-binding Mto2_bdg DUF3450 Sos7 DUF4407 Seadorna_VP6 Med21 bZIP_2 Herpes_UL25 Motif Other DBs NCBI-ProteinID:  QLA18756 LinkDB All DBs Position 702900..703076 Genome browser AA seq 58 aa AA seqDB search MDIFQALEDRVDRLLTKVKTLEAENGSLKAELDKERTNRDAITARVDSLLKRIQEEIA NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atggacattttccaagccctggaagaccgcgttgaccgccttttgaccaaggtcaagacc ctggaggcggagaacggttcgctcaaagccgaactcgacaaggagcgtacgaaccgggac gcgatcacggccagggtggattcgctgttgaagcggattcaggaggaaatcgcctga

DBGET integrated database retrieval system