Desulfitobacterium hafniense Y51: DSY4282 Help Entry DSY4282           CDS       T00333                                  Name (GenBank) hypothetical protein   KO K02437   glycine cleavage system H protein Organism dsy  Desulfitobacterium hafniense Y51 Pathway dsy00260   Glycine, serine and threonine metabolism dsy00630   Glyoxylate and dicarboxylate metabolism dsy00670   One carbon pool by folate dsy00785   Lipoic acid metabolism dsy01100   Metabolic pathways dsy01110   Biosynthesis of secondary metabolites dsy01200   Carbon metabolism Brite KEGG Orthology (KO) [BR:dsy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     DSY4282   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     DSY4282   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     DSY4282    00670 One carbon pool by folate     DSY4282 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GCV_H DUF1896 Motif Other DBs NCBI-ProteinID:  BAE86071 UniProt:  Q24PH1 LinkDB All DBs Position complement(4869592..4870002) Genome browser AA seq 136 aa AA seqDB search MAKAITELIFRDDLFYSDKHTWAKIEGEFVKIGITDFAQDQLGEILFVELPAVGDTYKKN DTFGQAESAKSVSQLYMPLSGSIVEINNLIEDSAEYVNEEPYDKGWMIVVEYSDSDEIEG LLSKLEYRQQIIAVSA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggccaaggcaattacggaattaatctttagagatgatcttttttattcagacaagcac acctgggcaaagattgaaggtgaatttgtgaaaattggtattactgatttcgcacaggat cagcttggagaaatcctctttgttgaattgcccgctgttggagatacttataagaaaaat gatacctttggtcaagctgaatcagcaaaaagcgtttctcagctttatatgcctttgagt ggttcaattgtcgagatcaataacttaatagaagattcagctgaatatgtgaatgaggaa ccgtatgataagggttggatgattgtggttgaatacagcgattcagacgaaatagagggg ctcctatccaagttggaatataggcagcagataatagctgtgtcagcatag

DBGET integrated database retrieval system