Dyella terrae: DYST_04601 Help Entry DYST_04601        CDS       T08348                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism dta  Dyella terrae Brite KEGG Orthology (KO) [BR:dta00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dta03110]     DYST_04601 Chaperones and folding catalysts [BR:dta03110]  Protein folding catalysts   Protein disulfide isomerase    DYST_04601 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 SH3BGR GST_N_2 Glrx-like DSBA Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  ULU27637 LinkDB All DBs Position 5028756..5029019 Genome browser AA seq 87 aa AA seqDB search MPKIEVYSSAVCPYCVSAKNLLKSKGLEWSEVRIDTDPSQRDVMLARSGGRRTVPQIFIN DHHVGGFDDLVAADRSGKLAELLETHA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgcccaagattgaggtctattccagcgcggtgtgtccgtactgcgtgtctgccaagaac ctgctcaagtccaaggggctggagtggagcgaggtgcgcatcgacaccgatccgtctcag cgcgacgtgatgctggcgcgcagcggcgggcgccgcaccgtgccgcagatttttatcaac gaccaccacgtgggtggttttgacgacctcgtcgccgccgatcgcagcggcaagcttgcc gaactgctggagacccatgcatga

DBGET integrated database retrieval system