Dyella terrae: DYST_04897 Help Entry DYST_04897        CDS       T08348                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dta  Dyella terrae Pathway dta01100   Metabolic pathways dta01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dta00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DYST_04897    00074 Mycolic acid biosynthesis     DYST_04897   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DYST_04897 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ULU27927 LinkDB All DBs Position 5328821..5329060 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVIEQLGVKEEEVTANASFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQQAVDYIKAHTKE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgtcatcgagcagctgggcgtgaaggaa gaggaagtcacggcgaacgcttcgttcgtggacgatctgggcgctgattcgctggacacc gtcgaactggtgatggctctcgaggaagaattcgagaccgaaatcccggacgaagaagcc gagaagatcaccacggtgcagcaggctgttgattacatcaaggcccacaccaaggagtga

DBGET integrated database retrieval system