KEGG   Dendrobates tinctorius (dyeing poison frog): 141094839
Entry
141094839         CDS       T11000                                 
Symbol
ARFRP1
Name
(RefSeq) ADP-ribosylation factor-related protein 1
  KO
K07952  ADP-ribosylation factor related protein 1
Organism
dtc  Dendrobates tinctorius (dyeing poison frog)
Brite
KEGG Orthology (KO) [BR:dtc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dtc04131]
    141094839 (ARFRP1)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dtc04031]
    141094839 (ARFRP1)
Membrane trafficking [BR:dtc04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    141094839 (ARFRP1)
GTP-binding proteins [BR:dtc04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arp
    141094839 (ARFRP1)
SSDB
Motif
Pfam: Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU ATP_bind_1
Other DBs
NCBI-GeneID: 141094839
NCBI-ProteinID: XP_073436921
LinkDB
Position
Unknown
AA seq 201 aa
MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQTKIRFCRNYKGMNLNKITTTVGLN
IGTIDVGKVRLMFWDLGGQEELQSLWDKYYAESHGVIYVIDSTDEMRLSESKHAFEKMIS
SEALEGVPILVLANKQDVEGCLSIPDIKTAFSDCINKIGKRDCLTQACSALSGRGVNEGV
EWMVKCVVRNIHRPPRQKDIT
NT seq 606 nt   +upstreamnt  +downstreamnt
atgtatactctgctgtccggtctttataagtacatgttccagaaggatgagtactgtatc
ctgatcctgggactggacaatgctggcaagacgacgtttttagaacagacgaaaatccgg
ttctgccgcaactacaaggggatgaacctcaacaagatcaccacgactgtgggcctgaac
attggcaccattgatgtgggaaaagttcggctgatgttctgggacctcggggggcaggag
gagcttcagtctttatgggataagtattatgcagagtcccatggagtcatatatgtgatt
gattccaccgatgagatgcgcctttcggagtccaaacatgcttttgagaagatgatcagc
agtgaagctctggaaggtgtgcccatcctggtcttggcaaataaacaagatgtggagggc
tgtctctccattcctgacatcaagacggccttcagtgactgcattaataagattgggaag
agggattgcctgacccaggcctgctctgccctatcagggaggggagtgaatgaaggagta
gaatggatggtaaaatgcgtcgtgagaaacattcatcgccctcccagacagaaggacatc
acatag

DBGET integrated database retrieval system