Dyella telluris: H8F01_04460 Help Entry H8F01_04460       CDS       T07969                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dtl  Dyella telluris Pathway dtl01100   Metabolic pathways dtl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dtl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H8F01_04460    00074 Mycolic acid biosynthesis     H8F01_04460   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H8F01_04460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Rad60-SLD PP-binding_2 DUF1493 CorC_HlyC Motif Other DBs NCBI-ProteinID:  QNK02404 UniProt:  A0A7G8Q6J6 LinkDB All DBs Position 963689..963940 Genome browser AA seq 83 aa AA seqDB search MSNVQQETFDIIAKQAKIELDTIKPESTLKDLGIASLDAIEVIFDIEEHFNINLPNEDTD FDGGTVGQLVEAIERQLALKTSE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcaacgttcagcaggaaaccttcgacatcatcgccaagcaggccaagatcgagctg gacacgatcaagccggagtcgaccctgaaggatctgggtatcgcctcgctggatgccatc gaagtgattttcgacatcgaagaacacttcaacatcaacctgcccaacgaagacaccgac ttcgacggcggcacggttggccagctcgttgaagccattgagcgccagctcgccctgaaa accagcgaataa

DBGET integrated database retrieval system