Dyella telluris: H8F01_09215 Help Entry H8F01_09215       CDS       T07969                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dtl  Dyella telluris Pathway dtl01100   Metabolic pathways dtl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dtl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H8F01_09215    00074 Mycolic acid biosynthesis     H8F01_09215   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H8F01_09215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QNK03259 UniProt:  A0A7G8Q901 LinkDB All DBs Position complement(2034046..2034315) Genome browser AA seq 89 aa AA seqDB search MAELSTAQNELATLIVESLNLDTVTADQMDPDAPLFGGDLGLDSIDALEIALAVSKRYGF QLRSDNPENRKIFTSLRTLSEHIERHRVV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggccgagctgagcaccgcacaaaacgaactggccacgctgatcgtggaaagcctcaat ctggacaccgtcacggctgaccagatggaccctgatgccccgcttttcggcggcgatctg ggcctggattccatcgacgcgctggaaatcgcactggccgtatcgaagcgatacggattc cagctgcgctcggataatcccgagaatcgcaagattttcaccagtctgcgcaccttgtcc gaacatatcgaacggcatcgcgtcgtttaa

DBGET integrated database retrieval system