Dietzia timorensis: BJL86_0972 Help Entry BJL86_0972        CDS       T04608                                  Name (GenBank) Hypothetical protein   KO K02078   acyl carrier protein Organism dtm  Dietzia timorensis Pathway dtm01100   Metabolic pathways dtm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dtm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BJL86_0972    00074 Mycolic acid biosynthesis     BJL86_0972   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BJL86_0972 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANI91765 UniProt:  A0A173LHM2 LinkDB All DBs Position complement(1042634..1042894) Genome browser AA seq 86 aa AA seqDB search MTDAAQARKRALDVVEAMAPNPPVGGLQPELRLIDDLGFDSLRLVELTMALEDALELDPI PQARLAGVMTVDAVQDLAAEMKGSGS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaccgacgccgcccaggcacgcaagcgggccctcgacgtcgtcgaggcgatggcaccg aacccgccggtcggcggtctacagccggaacttcgtctcatcgacgatctcggcttcgac tcgctccgcctcgtcgagctgacgatggcgctcgaggacgcactcgaactcgaccccatc ccccaggccaggctcgccggggtgatgacggtggatgcagtgcaggatctcgcggcagag atgaagggctccggatcatga

DBGET integrated database retrieval system