Dietzia timorensis: BJL86_1058 Help Entry BJL86_1058        CDS       T04608                                  Name (GenBank) Putative glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism dtm  Dietzia timorensis Brite KEGG Orthology (KO) [BR:dtm00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     BJL86_1058 Enzymes [BR:dtm01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      BJL86_1058 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 GST_N_3 Thioredoxin DUF6274 Thioredoxin_7 Glrx-like Motif Other DBs NCBI-ProteinID:  ANI91851 UniProt:  A0A173LK56 LinkDB All DBs Position complement(1142052..1142342) Genome browser AA seq 96 aa AA seqDB search MTAESTAVPGAPRDFTMFTTSWCPFCQRLKKLLDESETPYTEIDVEADSDAAAFVESVND GNRVVPTLLFSDGSTETNPGASKVRAKLDELAAAAE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgactgctgaatcgaccgctgtccccggcgccccgcgcgatttcacgatgttcaccacg agctggtgcccgttctgccagcgtctgaagaagctgctcgacgaatctgagacgccgtac acggagatcgatgtcgaggccgattcagacgccgccgcattcgtcgagtccgtgaatgac ggcaaccgggtcgttccgacattgctgttctccgacggatcgaccgagacgaaccccggc gcatcgaaggtgcgcgcgaagctcgacgaactcgccgctgctgccgaataa

DBGET integrated database retrieval system