Defluviitoga tunisiensis: DTL3_1242 Help Entry DTL3_1242         CDS       T03867                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dtn  Defluviitoga tunisiensis Pathway dtn00020   Citrate cycle (TCA cycle) dtn00720   Other carbon fixation pathways dtn01100   Metabolic pathways dtn01110   Biosynthesis of secondary metabolites dtn01120   Microbial metabolism in diverse environments dtn01200   Carbon metabolism dtn01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dtn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DTL3_1242   09102 Energy metabolism    00720 Other carbon fixation pathways     DTL3_1242 Enzymes [BR:dtn01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DTL3_1242 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_7 Fer4_6 Fer4_2 Fer4_9 Fer4_16 Fer4_21 Fer4_3 Fer4_17 Fer4_8 Fer4_4 Fer4_13 Fer4_5 Motif Other DBs NCBI-ProteinID:  CEP78540 UniProt:  A0A0C7P2J2 LinkDB All DBs Position I:1347192..1347401 Genome browser AA seq 69 aa AA seqDB search MQSTKKLYNVVINYNYCKRCGICSWICPVKAIVEGEFDIPQISDPLKCTGCLQCERMCPD FAIDVRLVE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtgcaatccacaaagaaattgtataatgtagtaataaactataattactgcaagagatgt ggaatttgttcttggatttgtcctgttaaagctatagttgaaggagaatttgatattcct caaatttctgatcctcttaaatgtacaggatgtcttcagtgtgaaaggatgtgtccggat tttgcaattgatgttagattagtggaatag

DBGET integrated database retrieval system