Desulfobacula toluolica: TOL2_C31340 Help Entry TOL2_C31340       CDS       T02268                                  Symbol fdx9 Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dto  Desulfobacula toluolica Pathway dto00020   Citrate cycle (TCA cycle) dto00720   Other carbon fixation pathways dto01100   Metabolic pathways dto01110   Biosynthesis of secondary metabolites dto01120   Microbial metabolism in diverse environments dto01200   Carbon metabolism dto01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dto00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     TOL2_C31340 (fdx9)   09102 Energy metabolism    00720 Other carbon fixation pathways     TOL2_C31340 (fdx9) Enzymes [BR:dto01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      TOL2_C31340 (fdx9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_21 Fer4_2 Fer4_4 Fer4_9 Fer4_16 Fer4_6 LdpA_Fe-S-bd Fer4_15 Fer4_17 Fer4_8 Fer4_ETF_QO Fer4_3 Fer4_13 Fer4_22 Regnase_1_C Motif Other DBs NCBI-ProteinID:  CCK81292 UniProt:  K0NQT6 LinkDB All DBs Position 3668868..3669095 Genome browser AA seq 75 aa AA seqDB search MGKGKTSKHLIDKEWCKGCGICIHFCPKNVLEFDEYGKAQAIRPEDCILCKLCEIRCPDL AIQVMEKEEGEEKNE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgggaaaaggcaaaacgtctaaacatttaattgacaaggaatggtgcaaagggtgtggt atctgcattcatttttgtccaaaaaatgtacttgaatttgatgagtacggaaaggcacaa gcaataaggcctgaggattgtattttatgcaaactgtgcgaaattagatgccccgattta gcaatacaagtcatggaaaaagaggaaggggaagagaaaaatgaataa

DBGET integrated database retrieval system