Dissulfurispira thermophila: JZK55_15750 Help Entry JZK55_15750       CDS       T07039                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism dtp  Dissulfurispira thermophila Brite KEGG Orthology (KO) [BR:dtp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dtp03036]     JZK55_15750 Chromosome and associated proteins [BR:dtp03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     JZK55_15750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Golgin_A5 PTRF_SDPR MLKL_N Herpes_UL6 Filament GapR_DNA-bd SPATA24 UPF0242 DivIC DUF3450 APG6_N CCCAP DUF2203 DUF7792 DUF724 MYO6_lever HALZ WHEP-TRS FlpD DUF641 Prefoldin_2 DUF16 FlxA AAA_13 FlaC_arch CCDC-167 ORF6C DUF1664 Mei5 Macoilin XLF_CC DUF6026 Motif Other DBs NCBI-ProteinID:  BCB96653 UniProt:  A0A7G1H3G1 LinkDB All DBs Position 1585475..1585696 Genome browser AA seq 73 aa AA seqDB search MEVLKTFDEKIAIAVEKVRSLKEEKERLEKRVKELEDALRLKDIEIERLGMEKSSIKNQI EDLLNELETIGLK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gtggaagtattgaaaacatttgatgagaaaatagccattgcagttgaaaaagtaaggtca ttaaaagaagaaaaagagagactcgaaaaaagagtcaaagaacttgaggatgcactcaga ttgaaagatatagaaatcgagagactcggcatggaaaagtcatccataaagaatcagata gaagacctactaaatgaactcgaaacaattgggcttaaatag

DBGET integrated database retrieval system