Candidatus Desulfovibrio trichonymphae: RSDT_0843 Help Entry RSDT_0843         CDS       T05578                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dtr  Candidatus Desulfovibrio trichonymphae Pathway dtr01100   Metabolic pathways dtr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dtr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RSDT_0843 (acpP)    00074 Mycolic acid biosynthesis     RSDT_0843 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RSDT_0843 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BAV92355 UniProt:  A0A1J1E376 LinkDB All DBs Position complement(1128221..1128457) Genome browser AA seq 78 aa AA seqDB search MSEIEAKVVKIIVEQLGVSIDEVKPDASFVEDLGADSLDLTELIMAMEEEFDIEIGDDDA QKILKVQDAVSYIENKKQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcggaaattgaagcgaaagttgttaaaattattgtggagcagttgggcgtgagcatt gacgaagtcaagccggatgcctcctttgtcgaagatctcggcgcggactctctggatctg acggaactgatcatggctatggaagaagaattcgacattgaaataggcgatgacgacgcg cagaagattcttaaggtgcaggatgccgtcagctatatagaaaataagaaacagtag

DBGET integrated database retrieval system