Delftia tsuruhatensis: BI380_01300 Help Entry BI380_01300       CDS       T04496                                  Name (GenBank) histone   KO K03746   DNA-binding protein H-NS Organism dts  Delftia tsuruhatensis Brite KEGG Orthology (KO) [BR:dts00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dts03036]     BI380_01300    03400 DNA repair and recombination proteins [BR:dts03400]     BI380_01300 Chromosome and associated proteins [BR:dts03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BI380_01300 DNA repair and recombination proteins [BR:dts03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BI380_01300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AOV00086 UniProt:  A0AAX3SGD8 LinkDB All DBs Position complement(265614..265892) Genome browser AA seq 92 aa AA seqDB search MTTYQELIAQKKLLDQQIDEARKLESKAALASVQELVREFGFTAQQVFPWKPDGKKSAPA KYQDPESGKTWTGRGKPPNWILGKDRTLFEIK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgactacataccaagagctgattgcccagaaaaaactgctcgaccagcaaatcgacgag gcccgcaagctggagtccaaagcggctctggcatcggtgcaggaactggtccgggagttt ggcttcacggcacagcaggtcttcccctggaagcccgatggcaagaagagcgcccccgcc aagtaccaggaccccgagtccggcaagacctggaccggccgcggcaagccgccgaactgg atcctgggtaaggaccgcaccctgttcgaaatcaagtga

DBGET integrated database retrieval system