Delftia tsuruhatensis: BI380_05645 Help Entry BI380_05645       CDS       T04496                                  Name (GenBank) histone   KO K03746   DNA-binding protein H-NS Organism dts  Delftia tsuruhatensis Brite KEGG Orthology (KO) [BR:dts00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dts03036]     BI380_05645    03400 DNA repair and recombination proteins [BR:dts03400]     BI380_05645 Chromosome and associated proteins [BR:dts03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BI380_05645 DNA repair and recombination proteins [BR:dts03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BI380_05645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS PLC-beta_C Motif Other DBs NCBI-ProteinID:  AOV00880 UniProt:  A0AAX3SCK9 LinkDB All DBs Position 1247521..1247796 Genome browser AA seq 91 aa AA seqDB search MSNTYKELLAQREALEAQIQTARKQEVSDVIAKIRGLVQDYGLTADDIFTARRASSTVAP KFRNPETGDTWTGRGKPPAWIKDKDRAQFAI NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgagcaacacatacaaagaacttctggcgcagcgcgaagcacttgaggcccagatccag acagcacgcaagcaagaagtcagtgatgtgatcgccaagattcgcggtctggttcaggat tacggcctgacagccgacgacattttcacggcacgccgcgcctcctccaccgtggccccc aagttccgcaatccagagacaggtgacacctggaccggacgcggcaagccgcccgcctgg atcaaggacaaggatcgcgcccagttcgccatctga

DBGET integrated database retrieval system