Delftia tsuruhatensis: BI380_15140 Help Entry BI380_15140       CDS       T04496                                  Name (GenBank) histone   KO K03746   DNA-binding protein H-NS Organism dts  Delftia tsuruhatensis Brite KEGG Orthology (KO) [BR:dts00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dts03036]     BI380_15140    03400 DNA repair and recombination proteins [BR:dts03400]     BI380_15140 Chromosome and associated proteins [BR:dts03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BI380_15140 DNA repair and recombination proteins [BR:dts03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BI380_15140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS TENA_THI-4 DUF4602 Motif Other DBs NCBI-ProteinID:  AOV02568 UniProt:  A0AAX3SR66 LinkDB All DBs Position 3247284..3247565 Genome browser AA seq 93 aa AA seqDB search MTADYKTLLKQKSELEARIAETLKAEKGGVIAKVRELVHEFGLTHDDIFSARKSKSANIG VPKYRDPATGATWTGRGKPPRWIEGKDRKALEI NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgacagcagattacaaaaccctgctcaagcaaaagagcgagcttgaggcacggattgcc gaaacgctgaaggcggagaaaggcggagtcatcgccaaggtccgagaactcgtccatgag ttcggattgacccacgacgacatcttcagcgcccgcaaatccaagtccgccaacattggc gtgccgaaataccgggaccccgccaccggagccacctggacgggacggggcaagccgccg cgctggatcgaaggcaaggaccgcaaggccctcgagatctga

DBGET integrated database retrieval system