Delftia tsuruhatensis: BI380_31290
Help
Entry
BI380_31290 CDS
T04496
Name
(GenBank) GNAT family N-acetyltransferase
KO
K09919
uncharacterized protein
Organism
dts
Delftia tsuruhatensis
Brite
KEGG Orthology (KO) [BR:
dts00001
]
09190 Not Included in Pathway or Brite
09194 Poorly characterized
99997 Function unknown
BI380_31290
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
FemAB_like
Acetyltransf_6
LPG_synthase_C
Motif
Other DBs
NCBI-ProteinID:
AOV05492
UniProt:
A0ABN4SPV4
LinkDB
All DBs
Position
complement(6865012..6866238)
Genome browser
AA seq
408 aa
AA seq
DB search
MAETAIITRVLDSVQQLDAQAWNALLASQAAPTPFMRHEYLSALESSGSAVPQTGWAARV
VTLWQGGELVAACPVYAKAHSYGEYVFDFAWARAYAQHGLDYYPKGVLAVPFTPVPGSRL
LARTPLLRAALVRAVREWAQAQKLSSLHLLFSDAEDLAACDADGWMQRSTVQFHWSNQNA
GGAGHRDFDHFLSTLNQEKRKKIRQERRKVHEAGVRFRAVHGPDMSAQDWAFFYRCHERT
YLEHGNAPYLQPAFFEAMAHQMPENWLMFVAERDGQPMACSLIALDAAAARLSADSCDRD
TPQIPHIPQGTAYGRYWGALERVDCLHFEACYYQPIAWCIERGIAHFEGGAQGEHKMARA
LLPVVTPSAHWIAHPSFADAISRFLDREGEGMAGYLQELQAHSPLRQD
NT seq
1227 nt
NT seq
+upstream
nt +downstream
nt
atggctgaaaccgcaattatcacccgcgtgctggacagcgtgcagcagctcgatgcccag
gcctggaatgcgctgctggcatcgcaggctgcgcccacccccttcatgcgccacgagtac
ctgagcgcgctggaatccagcggcagcgccgtgccgcaaaccggctgggccgcccgcgtg
gtcacgctctggcagggcggcgagctggtcgccgcctgcccggtctacgccaaggcgcat
tcctatggcgagtacgtgttcgactttgcctgggcgcgtgcctacgcccagcatgggctg
gattactaccccaagggcgtgctcgccgtgcctttcacgcctgtgccgggcagccggctg
ctggcacgcacgccgctgctgcgtgcggccctggtgcgcgccgtgcgcgaatgggcccag
gcgcagaagctgtcttccctgcatttgctgttcagcgatgccgaggatctggcagcctgc
gacgccgacggctggatgcagcgcagcaccgtgcagttccactggagcaaccagaacgcc
gggggtgcgggccaccgggacttcgaccactttctttccacgctgaaccaggaaaagcgc
aagaagattcgccaggaacggcgcaaggtgcacgaggccggcgtgcgctttcgagcagtg
cacggccccgacatgagcgcccaggactgggccttcttctaccgctgccacgaacgcacc
tatctggaacacggcaacgccccgtacctccagccggccttcttcgaggccatggcgcac
cagatgcccgagaactggctgatgttcgtcgccgagcgcgacggccaacccatggcctgc
agcctgatcgcactcgacgcggcagccgcacggctttcggccgacagttgcgaccgcgac
acgccgcagatcccgcacatcccgcagggcacggcctacggccgctactggggcgcgctg
gagcgcgtggactgcctgcatttcgaggcctgctactaccagcctatcgcctggtgcata
gaacgcgggattgcgcacttcgagggaggcgcccagggcgaacacaagatggcgcgggcg
ctgctgcccgtggtgacgcccagcgcccactggattgcccacccgtccttcgccgacgcc
atctcgcgctttctggaccgcgagggcgaaggcatggccggctacctgcaggagctgcag
gcgcacagcccgctgcgccaggactga
DBGET
integrated database retrieval system