Dyella thiooxydans: ATSB10_15290 Help Entry ATSB10_15290      CDS       T04308                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dtx  Dyella thiooxydans Pathway dtx01100   Metabolic pathways dtx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dtx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ATSB10_15290    00074 Mycolic acid biosynthesis     ATSB10_15290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ATSB10_15290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding SAM_5 Motif Other DBs NCBI-ProteinID:  AND68983 UniProt:  A0A160MZU5 LinkDB All DBs Position 1634023..1634310 Genome browser AA seq 95 aa AA seqDB search MNAVIDTASLEQDIAGLIIDTLNLEDLQPGDIPPDQPLFRDGLGLDSVDALELALALQKR YGIRVESDAKNAREHFATVANLAAYVASQQAPCAD NT seq 288 nt NT seq  +upstreamnt  +downstreamnt gtgaacgccgtcatcgacaccgcctcgctggaacaggacatcgccggcctcatcatcgac acgctgaacctggaagacctccagcccggcgacatcccgcccgaccagccgttgttccgc gacggcctgggactggattcggtggacgcgctggagctggcgctggcgctgcagaagcgc tacggcatccgcgtcgagtcggacgcgaagaacgcgcgcgagcactttgccaccgtcgcc aaccttgccgcctacgtcgcgtcccagcaggccccatgcgccgactga

DBGET integrated database retrieval system