Dehalococcoides sp. UCH007: UCH007_11880 Help Entry UCH007_11880      CDS       T03880                                  Symbol groES Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism duc  Dehalococcoides sp. UCH007 Brite KEGG Orthology (KO) [BR:duc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:duc03110]     UCH007_11880 (groES)    03029 Mitochondrial biogenesis [BR:duc03029]     UCH007_11880 (groES) Chaperones and folding catalysts [BR:duc03110]  Heat shock proteins   HSP10    UCH007_11880 (groES) Mitochondrial biogenesis [BR:duc03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     UCH007_11880 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  BAQ35146 UniProt:  A0A0C6EF84 LinkDB All DBs Position 1153937..1154233 Genome browser AA seq 98 aa AA seqDB search MAIRFEPLHNMVLIQPQEKQDMSKGGIIIPDAAQEKSQEGLIVAVGPGRLDKDGKREVMS IKVGDKVLFPKFGGVELKSGGIEYIIMPESQIMAKIVG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcaattagattcgaacccctgcacaacatggtactcatccaaccccaggaaaaacag gatatgagcaaaggcggcatcatcatccccgacgccgctcaggaaaaatcccaggaaggc ttgatagtagccgtgggtcccggccgtctggataaagatggcaaacgcgaagttatgagc attaaagtcggcgacaaggttcttttccccaaattcggcggtgttgaacttaaatctggc ggcattgagtatatcatcatgcccgaaagccagattatggctaaaatcgtaggctaa

DBGET integrated database retrieval system