Duganella dendranthematis: HH213_02355 Help Entry HH213_02355       CDS       T06560                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism dug  Duganella dendranthematis Pathway dug02024   Quorum sensing dug03018   RNA degradation Brite KEGG Orthology (KO) [BR:dug00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HH213_02355 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HH213_02355 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dug03019]     HH213_02355 (hfq)    03036 Chromosome and associated proteins [BR:dug03036]     HH213_02355 (hfq) Messenger RNA biogenesis [BR:dug03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HH213_02355 (hfq) Chromosome and associated proteins [BR:dug03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HH213_02355 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 SRP14 Motif Other DBs NCBI-ProteinID:  QJD89056 UniProt:  A0ABX6M507 LinkDB All DBs Position complement(488462..488698) Genome browser AA seq 78 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGHIESFDQYVVLLRNTVTQMVYKHAI STVVPARAVNLNIENEAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaataaagggcaactgttacaagacccattcctgaacgccttgcgcaaggaacac gttcctgtttcgatctacctggtcaacggcatcaagctgcaaggccacatcgaatcgttc gaccagtacgtcgtactgctgcgtaacactgtgacccagatggtgtacaagcacgccatc tccaccgtggtgccggcgcgcgccgtcaacctcaatattgaaaacgaagcggaataa

DBGET integrated database retrieval system