Duncaniella sp. C9: E7745_10270 Help Entry E7745_10270       CDS       T09932                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism duq  Duncaniella sp. C9 Brite KEGG Orthology (KO) [BR:duq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:duq03032]     E7745_10270    03036 Chromosome and associated proteins [BR:duq03036]     E7745_10270    03400 DNA repair and recombination proteins [BR:duq03400]     E7745_10270 DNA replication proteins [BR:duq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E7745_10270 Chromosome and associated proteins [BR:duq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E7745_10270 DNA repair and recombination proteins [BR:duq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E7745_10270 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding Motif Other DBs NCBI-ProteinID:  QCD39882 LinkDB All DBs Position complement(2446339..2446617) Genome browser AA seq 92 aa AA seqDB search MDNKQFISRLGKRLNRENAEVATLVEGLCKVFKECGADLDSIAIPGFGTFKSVKSDEAIV YDEVNGKRTLVPPAIRMEFAPSIVLRKKMTKQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtggataacaaacaatttatttcacgactcggcaagagactaaaccgggaaaacgcagaa gtggccacactcgttgaaggtctgtgcaaagtattcaaagaatgcggagccgatcttgac tcaatcgccatccccggattcggaacattcaaatctgtaaaatcagatgaggcgattgtt tacgacgaagtaaacggcaaacgcacattggttccgccagccatcagaatggaatttgcc cccagcattgtattgcgaaaaaaaatgactaaacaatga

DBGET integrated database retrieval system