Dactylosporangium vinaceum: Dvina_05275 Help Entry Dvina_05275       CDS       T07478                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism dvc  Dactylosporangium vinaceum Brite KEGG Orthology (KO) [BR:dvc00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Dvina_05275 Enzymes [BR:dvc01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      Dvina_05275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Glrx-like GST_N_3 Thioredoxin_2 Thioredoxin Motif Other DBs NCBI-ProteinID:  UAC01488 LinkDB All DBs Position complement(1148235..1148477) Genome browser AA seq 80 aa AA seqDB search MLTMYSTTWCGYCHRLKTQMDREGIQYQVVDIEQNPEAAKFVETVNGGNQTVPTLRFDDG TAMTNPSIVQVKKHLETVGS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgctgaccatgtactccaccacctggtgcggctactgccaccggctcaagacccagatg gaccgggagggcatccagtaccaggtggtcgacatcgagcagaacccggaggcggcgaag ttcgtcgagaccgtcaacggcggcaaccagacggtgccgaccctgcgcttcgacgacggc acggcgatgaccaaccccagcatcgtgcaggtcaagaagcatttggaaaccgtcggtagc tga

DBGET integrated database retrieval system